Recombinant Human PLTP
Cat.No. : | PLTP-30291TH |
Product Overview : | Recombinant full length Human PLTP, isoform 2 with N terminal proprietary tag, 72.05kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 423 amino acids |
Molecular Weight : | 72.050kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Wide tissue distribution. Placenta >pancreas >lung >kidney >heart >liver >skeletal muscle >brain. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKE GHFYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLG LRFRRQLLYWFLKVYDFLSTFITSGMRFLLNQQICPVLYH AGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNL DMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSE FFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGS IVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASV TIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDL RRFRIYSNHSALESLALIPLQAPLKTMLQIGVMPMLNERT WRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLRE VIEKNRPADVRASTAPTPSTAAV |
Sequence Similarities : | Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family. |
Gene Name : | PLTP phospholipid transfer protein [ Homo sapiens ] |
Official Symbol : | PLTP |
Synonyms : | PLTP; phospholipid transfer protein; BPI fold containing family E; BPIFE; |
Gene ID : | 5360 |
mRNA Refseq : | NM_001242920 |
Protein Refseq : | NP_001229849 |
Uniprot ID : | P55058 |
Chromosome Location : | 20q13.12 |
Pathway : | Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; |
Function : | lipid binding; |
Products Types
◆ Recombinant Protein | ||
PLTP-1490H | Recombinant Human PLTP Protein (18-493 aa), His-tagged | +Inquiry |
PLTP-2152H | Recombinant Human PLTP Protein, MYC/DDK-tagged | +Inquiry |
PLTP-2600H | Recombinant Human PLTP Protein, His-tagged | +Inquiry |
Pltp-6861M | Recombinant Mouse Pltp Protein, His (Fc)-Avi-tagged | +Inquiry |
PLTP-728H | Recombinant Human PLTP Protein (18-493 aa), GST-tagged | +Inquiry |
◆ Lysates | ||
PLTP-2065HCL | Recombinant Human PLTP cell lysate | +Inquiry |
◆ Assay kits | ||
Kit-0708 | PLTP Activity Fluorometric Assay Kit | +Inquiry |
Kit-0709 | PLTP Activity Fluorometric Assay Kit II | +Inquiry |
Kit-0707 | PLTP Activity Assay Kit | +Inquiry |
Kit-0710 | PLTP Inhibitor Drug Screening Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket