"PLTP" Related Products

Expand
Expand
Expand

Recombinant Human PLTP

Cat.No.: PLTP-30291TH
Product Overview: Recombinant full length Human PLTP, isoform 2 with N terminal proprietary tag, 72.05kDa.
Description: The protein encoded by this gene is one of at least two lipid transfer proteins found in human plasma. The encoded protein transfers phospholipids from triglyceride-rich lipoproteins to high density lipoprotein (HDL). In addition to regulating the size of HDL particles, this protein may be involved in cholesterol metabolism. At least two transcript variants encoding different isoforms have been found for this gene.
Protein length: 423 amino acids
Molecular Weight: 72.050kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Wide tissue distribution. Placenta >pancreas >lung >kidney >heart >liver >skeletal muscle >brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: FPGCKIRVTSKALELVKQEGLRFLEQELETITIPDLRGKE GHFYYNISEVKVTELQLTSSELDFQPQQELMLQITNASLG LRFRRQLLYWFLKVYDFLSTFITSGMRFLLNQQICPVLYH AGTVLLNSLLDTVPVRSSVDELVGIDYSLMKDPVASTSNL DMDFRGAFFPLTERNWSLPNRAVEPQLQEEERMVYVAFSE FFFDSAMESYFRAGALQLLLVGDKVPHDLDMLLRATYFGS IVLLSPAVIDSPLKLELRVLAPPRCTIKPSGTTISVTASV TIALVPPDQPEVQLSSMTMDARLSAKMALRGKALRTQLDL RRFRIYSNHSALESLALIPLQAPLKTMLQIGVMPMLNERT WRGVQIPLPEGINFVHEVVTNHAGFLTIGADLHFAKGLRE VIEKNRPADVRASTAPTPSTAAV
Sequence Similarities: Belongs to the BPI/LBP/Plunc superfamily. BPI/LBP family.
Gene Name: PLTP phospholipid transfer protein [ Homo sapiens ]
Official Symbol: PLTP
Synonyms: PLTP; phospholipid transfer protein; BPI fold containing family E; BPIFE;
Gene ID: 5360
mRNA Refseq: NM_001242920
Protein Refseq: NP_001229849
Uniprot ID: P55058
Chromosome Location: 20q13.12
Pathway: Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem;
Function: lipid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.