"SELP" Related Products

Expand
Expand
Expand

Recombinant Human SELP

Cat.No.: SELP-27886TH
Product Overview: Recombinant fragment, corresponding to the signal peptide and the extracellular amino acids 1-771 of Human CD62P, expressed in modified human 293 cells, 85kDa.
Description: This gene encodes a 140 kDa protein that is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. This protein redistributes to the plasma membrane during platelet activation and degranulation and mediates the interaction of activated endothelial cells or platelets with leukocytes. The membrane protein is a calcium-dependent receptor that binds to sialylated forms of Lewis blood group carbohydrate antigens on neutrophils and monocytes. Alternative splice variants may occur but are not well documented.
Tissue specificity: Stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin, PBS
Storage: Shipped at 4°C. After reconstitution store at -20oC. Avoid freeze / thaw cycles.
Sequences of amino acids: Theoretical sequence:MANCQIAILYQRFQRVVFGISQLLCFSAL ISELTNQKEVAAWTYHYSTKAYSWNISRKYCQNRYTDL VAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTK KALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKW NDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSC YPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFN SQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQ CPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGP EVVQCTASGVWTAPAPVCKAVQCQHLEAPNEGTMDCVH PLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAP LPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCA EGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPN EARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYK STCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIK CPELFAPEQGSLDCSDTRGEFNVGSTCHFSCNNGFKLEGP NNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPG QGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCR PSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYG SICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGP LTIQEA
Sequence Similarities: Belongs to the selectin/LECAM family.Contains 1 C-type lectin domain.Contains 1 EGF-like domain.Contains 9 Sushi (CCP/SCR) domains.
Gene Name: SELP selectin P (granule membrane protein 140kDa, antigen CD62) [ Homo sapiens ]
Official Symbol: SELP
Synonyms: SELP; selectin P (granule membrane protein 140kDa, antigen CD62); GRMP, selectin P (granule membrane protein 140kD, antigen CD62); P-selectin; CD62; CD62P; GMP140; PADGEM; PSEL;
Gene ID: 6403
mRNA Refseq: NM_003005
Protein Refseq: NP_002996
Uniprot ID: P16109
Chromosome Location: 1q22-q25
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem;
Function: calcium-dependent protein binding; eukaryotic cell surface binding; fucose binding; glycoprotein binding; glycosphingolipid binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.