"SERPINB3" Related Products

Expand
Expand

Recombinant Human SERPINB3

Cat.No.: SERPINB3-31188TH
Product Overview: Recombinant full length Human SerpinB3 protein with an N terminal proprietary tag; predicted mwt: 68.97 kDa inclusive of tag.
Description: Serpin B3 is a protein that in humans is encoded by the SERPINB3 gene.
Protein length: 390 amino acids
Molecular Weight: 68.970kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGM VLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGN VHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYL DAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIK NLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKF WPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKD LSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRV DLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGS RGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTN EEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Sequence Similarities: Belongs to the serpin family. Ov-serpin subfamily.
Gene Name: SERPINB3 serpin peptidase inhibitor, clade B (ovalbumin), member 3 [ Homo sapiens ]
Official Symbol: SERPINB3
Synonyms: SERPINB3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SCC, SCCA1, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serpin B3; HsT1196; T4 A;
Gene ID: 6317
mRNA Refseq: NM_006919
Protein Refseq: NP_008850
MIM: 600517
Uniprot ID: P29508
Chromosome Location: 18q21.3
Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function: peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.