Description : |
The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. |
Protein length : |
188 amino acids |
Molecular Weight : |
46.750kDa inclusive of tags |
Source : |
Wheat germ |
Tissue specificity : |
Expressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and |
Form : |
Liquid |
Purity : |
Proprietary Purification |
Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKM KYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQ GNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDE NDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRG KHAWTHRLRERKQLVIYEEISDPEEDDE |
Sequence Similarities : |
Belongs to the SSX family.Contains 1 KRAB-related domain. |