Recombinant Human SSX1 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : SSX1-021H
Product Overview : SSX1 MS Standard C13 and N15-labeled recombinant protein (NP_005626) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneous humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. This gene, and also the SSX2 and SSX4 family members, have been involved in t(X;18)(p11.2;q11.2) translocations that are characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are likely responsible for transforming activity. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene has been identified on chromosome X.
Molecular Mass : 21.9 kDa
AA Sequence : MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SSX1 SSX family member 1 [ Homo sapiens (human) ]
Official Symbol SSX1
Synonyms SSX1; SSX family member 1; CT5.1; SSRC; protein SSX1; cancer/testis antigen 5.1; cancer/testis antigen family 5, member 1; sarcoma, synovial, X-chromosome-related 1; synovial sarcoma, X breakpoint 1
Gene ID 6756
mRNA Refseq NM_005635
Protein Refseq NP_005626
MIM 312820
UniProt ID Q16384

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SSX1 Products

Required fields are marked with *

My Review for All SSX1 Products

Required fields are marked with *

0
cart-icon