Recombinant Pig PMAP36 Protein (130-166 aa), His-SUMO-tagged

Cat.No. : PMAP36-1864P
Product Overview : Recombinant Pig PMAP36 Protein (130-166 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Pig
Source : E.coli
Tag : His&SUMO
Protein Length : 130-166 aa
Description : Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 20.3 kDa
AA Sequence : VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name PMAP-36 antibacterial peptide [ Sus scrofa (pig) ]
Official Symbol PMAP36
Synonyms PMAP36;
Gene ID 100170124
mRNA Refseq NM_001129965
Protein Refseq NP_001123437
UniProt ID P49931

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PMAP36 Products

Required fields are marked with *

My Review for All PMAP36 Products

Required fields are marked with *

0
cart-icon
0
compare icon