"YBX1" Related Products

Expand
Expand
Expand

Recombinant Human YBX1, GST-tagged

Cat.No.: YBX1-4839H
Product Overview: Human YBX1 full-length ORF (1 a.a. - 324 a.a.) recombinant protein with GST-tag at N-terminal.
Description: Y box binding protein 1 also known as Y-box transcription factor or nuclease-sensitive element-binding protein 1 is a protein that in humans is encoded by the YBX1 gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 62.3 kDa
AA Sequence: MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFI NRNDTKEDVFVHQTA IKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYP RRRGPPRNYQQNYQNSESGEKNEGSESAPEG QAQQRRPYRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADN QGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDE TQGQQPPQRRYRRNFNYRRRRPENPKP QDGKETKAADPPAENSSAPEAEQGGAE
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: YBX1 Y box binding protein 1 [ Homo sapiens (human) ]
Official Symbol: YBX1
Synonyms: YBX1; YB1; BP-8; CSDB; DBPB; YB-1; CSDA2; NSEP1; NSEP-1; MDR-NF1; Y box binding protein 1; nuclease-sensitive element-binding protein 1; CBF-A; EFI-A; DNA-binding protein B; Y-box-binding protein 1; Y-box transcription factor; enhancer factor I subunit A; nuclease sensitive element binding protein 1; CCAAT-binding transcription factor I subunit A; major histocompatibility complex, class II, Y box-binding protein I
Gene ID: 4904
mRNA Refseq: NM_004559
Protein Refseq: NP_004550
MIM: 154030
UniProt ID: P67809
Chromosome Location: 1p34
Pathway: BDNF signaling pathway; Processing of Capped Intron-Containing Pre-mRNA; SIDS Susceptibility Pathways
Function: double-stranded DNA binding; protein binding; sequence-specific DNA binding transcription factor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.