Recombinant Mouse YBX1 Protein (2-322 aa), His-tagged
Cat.No. : | YBX1-1557M |
Product Overview : | Recombinant Mouse YBX1 Protein (2-322 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-322 aa |
Description : | Mediates pre-mRNA alternative splicing regulation. Component of the CRD-mediated complex that promotes MYC mRNA stability. Binds to splice sites in pre-mRNA and regulates splice site selection. Binds and stabilizes Cytoplasmic domain mRNA. Contributes to the regulation of translation by modulating the interaction between the mRNA and eukaryotic initiation factors. Binds to promoters that contain a Y-box (5'-CTGATTGGCCAA-3'), such as HLA class II genes. Regulates the transcription of numerous genes. Promotes separation of DNA strands that contain mismatches or are modified by cisplatin. Has endonucleolytic activity and can introduce nicks or breaks into double-stranded DNA (in vitro). May play a role in DNA repair. Its transcriptional activity on the multidrug resistance gene MDR1 is enhanced in presence of the APEX1 acetylated form at 'Lys-6' and 'Lys-7'. Binds preferentially to 5'-[CU]CUGCG-3' motif in vitro .The secreted form acts as an Extracellular domain mitogen and stimulates cell migration and proliferation. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.6 kDa |
AA Sequence : | SSEAETQQPPAAPAAALSAADTKPGSTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYARRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Ybx1 Y box protein 1 [ Mus musculus ] |
Official Symbol | YBX1 |
Synonyms | YBX1; CBF-A; EFI-A; EF1A; MSY1; YB-1; dbpB; Nsep1; C79409; mYB-1a; 1700102N10Rik; MGC118070; |
Gene ID | 22608 |
mRNA Refseq | NM_011732 |
Protein Refseq | NP_035862 |
UniProt ID | P62960 |
◆ Recombinant Proteins | ||
YBX1-4852H | Recombinant Human YBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
YBX1-1557M | Recombinant Mouse YBX1 Protein (2-322 aa), His-tagged | +Inquiry |
YBX1-10250M | Recombinant Mouse YBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
YBX1-5984C | Recombinant Chicken YBX1 | +Inquiry |
YBX1-30136TH | Recombinant Human YBX1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YBX1-1945HCL | Recombinant Human YBX1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All YBX1 Products
Required fields are marked with *
My Review for All YBX1 Products
Required fields are marked with *
0
Inquiry Basket