"TOP1" Related Products

Expand
Expand

Recombinant Human TOP1, His-tagged

Cat.No.: TOP1-3745H
Product Overview: Recombinant human topoisomerase I produced in Sf9 cells is a single polypeptide chain with a 6His tag at the N-terminus. It contains 779 (15+764) amino acids having a predicted molecular mass of approximately 92.5kD, but migrates in SDS-PAGE with an apparent molecular mass of 105kD.
Description: This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This enzyme catalyzes the transient breaking and rejoining of a single strand of DNA which allows the strands to pass through one another, thus altering the topology of DNA. This gene is localized to chromosome 20 and has pseudogenes which reside on chromosomes 1 and 22.
Source: Baculovirus
Species: Human
Tag: His
Form: 20mM Tris-Cl (pH7.9), 20% Glycerol, 100mM NaCl, 1mM DTT and 0.5mM EDTA
Bio-activity: DNA Topoisomerase I catalyzes the latering the topology of DNA during transcription and replication. Recombinant Topo I protein is ideal for the studies of DNA topology and other related function assays.
AA Sequence: MHHHHHHGRRASVEFSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEPEDDGYFVPPKEDIK PLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKDKDKKVPEPDNKKKKPKKEEEQKWKWWE EERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKD WRKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFK IEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIM LNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADT VGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNK HLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQ TKIDAKKEQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLN YLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Purity: ≥90%, as determined by SDS-PAGE
Usage: FOR RESEARCH ONLY
Storage: The protein sample can be stored under sterile conditions at 2- 8 centigrade for one month or at -70 centigrade for three months without detectable loss of activity. Avoid repeated freeze-thaw cycles.
Gene Name: TOP1 topoisomerase (DNA) I [ Homo sapiens ]
Official Symbol: TOP1
Synonyms: TOPI; DNA topoisomerase 1; type I DNA topoisomerase
Gene ID: 7150
mRNA Refseq: NM_003286
Protein Refseq: NP_003277
MIM: 126420
UniProt ID: P11387
Chromosome Location: 20q12-q13.1
Pathway: Caspase cascade in apoptosis, organism-specific biosystem; Integrated Pancreatic Cancer Pathway, organism-specific biosystem

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.