Recombinant Human CDX2
Cat.No. : | CDX2-27917TH |
Product Overview : | Recombinant full length Human CDX2 with N terminal proprietary tag, 60.54kDa. |
- Specification
- Gene Information
- Related Products
Description : | The level and beta-cell specificity of insulin gene expression are regulated by a set of nuclear proteins that bind to specific sequences within the promoter of the insulin gene (INS; MIM 176730) and interact with RNA polymerase to activate or repress transcription. The proteins LMX1 (MIM 600298) and CDX3 are homeodomain proteins that bind an A/T-rich sequence in the insulin promoter and stimulate its transcription (German et al. |
Protein length : | 313 amino acids |
Molecular Weight : | 60.540kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDY GGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGY APGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPH HHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGG QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAK ERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPE PLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |
Sequence Similarities : | Belongs to the Caudal homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name : | CDX2 caudal type homeobox 2 [ Homo sapiens ] |
Official Symbol : | CDX2 |
Synonyms : | CDX2; caudal type homeobox 2; caudal type homeo box transcription factor 2 , CDX3; homeobox protein CDX-2; |
Gene ID : | 1045 |
mRNA Refseq : | NM_001265 |
Protein Refseq : | NP_001256 |
MIM : | 600297 |
Uniprot ID : | Q99626 |
Chromosome Location : | 13q12.2 |
Pathway : | Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Synthesis, Secretion, and Inactivation of Glucagon-like Peptide-1 (GLP-1), organism-specific biosystem; |
Function : | sequence-specific DNA binding transcription factor activity; transcription corepressor activity; transcription regulatory region sequence-specific DNA binding; |
Products Types
◆ Recombinant Protein | ||
CDX2-1083H | Recombinant Human CDX2 Protein, GST-Tagged | +Inquiry |
CDX2-600H | Recombinant Human CDX2 Protein, His/GST-tagged | +Inquiry |
CDX2-1552M | Recombinant Mouse CDX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDX2-11075H | Recombinant Human CDX2, His-tagged | +Inquiry |
CDX2-3242M | Recombinant Mouse CDX2 Protein | +Inquiry |
◆ Lysates | ||
CDX2-7602HCL | Recombinant Human CDX2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket