Recombinant Human CDX2 Protein, GST-Tagged
| Cat.No. : | CDX2-1083H |
| Product Overview : | Human CDX2 full-length ORF (AAH14461.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis. [provided by RefSeq, Jan 2012] |
| Molecular Mass : | 60.17 kDa |
| AA Sequence : | MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CDX2 caudal type homeobox 2 [ Homo sapiens ] |
| Official Symbol | CDX2 |
| Synonyms | CDX2; caudal type homeobox 2; caudal type homeo box transcription factor 2, CDX3; homeobox protein CDX-2; caudal-type homeobox protein 2; caudal type homeobox transcription factor 2; caudal type homeo box transcription factor 2; CDX3; CDX-3; |
| Gene ID | 1045 |
| mRNA Refseq | NM_001265 |
| Protein Refseq | NP_001256 |
| MIM | 600297 |
| UniProt ID | Q99626 |
| ◆ Recombinant Proteins | ||
| CDX2-27917TH | Recombinant Human CDX2 | +Inquiry |
| CDX2-75HF | Recombinant Full Length Human CDX2 Protein | +Inquiry |
| CDX2-3242M | Recombinant Mouse CDX2 Protein | +Inquiry |
| CDX2-1186H | Recombinant Human CDX2 Protein (Met1-Gln313), N-GST tagged | +Inquiry |
| CDX2-11075H | Recombinant Human CDX2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CDX2-7602HCL | Recombinant Human CDX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CDX2 Products
Required fields are marked with *
My Review for All CDX2 Products
Required fields are marked with *



