Recombinant Human CDX2 Protein, GST-Tagged

Cat.No. : CDX2-1083H
Product Overview : Human CDX2 full-length ORF (AAH14461.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded protein is a major regulator of intestine-specific genes involved in cell growth an differentiation. This protein also plays a role in early embryonic development of the intestinal tract. Aberrant expression of this gene is associated with intestinal inflammation and tumorigenesis. [provided by RefSeq, Jan 2012]
Molecular Mass : 60.17 kDa
AA Sequence : MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGPNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVSGSVPGVLGPTGGVLNPTVTQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CDX2 caudal type homeobox 2 [ Homo sapiens ]
Official Symbol CDX2
Synonyms CDX2; caudal type homeobox 2; caudal type homeo box transcription factor 2, CDX3; homeobox protein CDX-2; caudal-type homeobox protein 2; caudal type homeobox transcription factor 2; caudal type homeo box transcription factor 2; CDX3; CDX-3;
Gene ID 1045
mRNA Refseq NM_001265
Protein Refseq NP_001256
MIM 600297
UniProt ID Q99626

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CDX2 Products

Required fields are marked with *

My Review for All CDX2 Products

Required fields are marked with *

0
cart-icon