"DNAJB11" Related Products

Expand
Expand

Recombinant Human DNAJB11, His-tagged

Cat.No.: DNAJB11-28367TH
Product Overview: Recombinant fragment, corresponding to amino acids 44-358 of Human DNAJB11 with an N terminal His tag. Predicted mwt: 37 kDa;
Description: DNAJB11 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed.
Form: Lyophilised:Reconstitute with 107 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKR KQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTP RQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVAR QAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNV KLVNEERTLEVEIEPGVRDGMEYPFIGEGEPHVDGEPG DLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDI THLDGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIK GSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYN GLQGY
Sequence Similarities: Contains 1 J domain.
Gene Name: DNAJB11 DnaJ (Hsp40) homolog, subfamily B, member 11 [ Homo sapiens ]
Official Symbol: DNAJB11
Synonyms: DNAJB11; DnaJ (Hsp40) homolog, subfamily B, member 11; dnaJ homolog subfamily B member 11; EDJ; ERdj3; HEDJ;
Gene ID: 51726
mRNA Refseq: NM_016306
Protein Refseq: NP_057390
MIM: 611341
Uniprot ID: Q9UBS4
Chromosome Location: 3q27
Pathway: Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; Unfolded Protein Response, organism-specific biosystem;
Function: heat shock protein binding; unfolded protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.