"IFNAR1" Related Products

Expand
Expand

Recombinant Human IFNAR1

Cat.No.: IFNAR1-29420TH
Product Overview: Recombinant fragment corresponding to amino acids 28-127 of Human IFNAR1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: IFN receptors are present in all tissues and even on the surface of most IFN-resistant cells. Isoform 1, isoform 2 and isoform 3 are expressed in the IFN-alpha sensitive myeloma cell line U266S. Isoform 2 and isoform 3 are expressed in the IFN-alpha resis
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KNLKSPQKVEVDIIDDNFILRWNRSDESVGNVTFSFDYQKTGMDNWIKLSGCQNITSTKCNFSSLKLNVYEEIKLRIRAEKENTSSWYEVDSFTPFRKAQ
Sequence Similarities: Belongs to the type II cytokine receptor family.Contains 3 fibronectin type-III domains.
Gene Name: IFNAR1 interferon (alpha, beta and omega) receptor 1 [ Homo sapiens ]
Official Symbol: IFNAR1
Synonyms: IFNAR1; interferon (alpha, beta and omega) receptor 1; IFNAR; interferon alpha/beta receptor 1; IFRC;
Gene ID: 3454
mRNA Refseq: NM_000629
Protein Refseq: NP_000620
MIM: 107450
Uniprot ID: P17181
Chromosome Location: 21q22.1
Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; Hepatitis C, organism-specific biosystem;
Function: receptor activity; type I interferon receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.