Recombinant Human INPP5K, His-tagged
Cat.No. : | INPP5K-31407TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 51-372 of Human SKIP isoform 2, with N terminal His tag; 332 amino acids, 39kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Ubiquitously expressed with highest levels in skeletal muscle, heart and kidney. |
Form : | Lyophilised:Reconstitution with 94 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GNKGGVNICLKLYGYYVSIINCHLPPHISNNYQRLEHFDR ILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHF VRESIKNRCYGGLWEKDQLSIAKKHDPLLREFQEGRLL FPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTF DLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFP SSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLN QVYIDISNIPTTEDEFLLCYYSNSLRSVVGISRPFQIPPG SLREDPLGEAQPQI |
Sequence Similarities : | Belongs to the inositol-1,4,5-trisphosphate 5-phosphatase type II family. |
Gene Name : | INPP5K inositol polyphosphate-5-phosphatase K [ Homo sapiens ] |
Official Symbol : | INPP5K |
Synonyms : | INPP5K; inositol polyphosphate-5-phosphatase K; inositol polyphosphate 5-phosphatase K; skeletal muscle and kidney enriched inositol phosphatase; SKIP; |
Gene ID : | 51763 |
mRNA Refseq : | NM_001135642 |
Protein Refseq : | NP_001129114 |
MIM : | 607875 |
Uniprot ID : | Q9BT40 |
Chromosome Location : | 17p13.3 |
Pathway : | 1D-myo-inositol hexakisphosphate biosynthesis II (mammalian), conserved biosystem; 3-phosphoinositide degradation, conserved biosystem; D-myo-inositol (1,3,4)-trisphosphate biosynthesis, conserved biosystem; D-myo-inositol (1,4,5)-trisphosphate degradation, conserved biosystem; Inositol phosphate metabolism, organism-specific biosystem; |
Function : | hydrolase activity; inositol 1,3,4,5-tetrakisphosphate 5-phosphatase activity; inositol bisphosphate phosphatase activity; inositol trisphosphate phosphatase activity; inositol-1,4,5-trisphosphate 5-phosphatase activity; |
Products Types
◆ Recombinant Protein | ||
Inpp5k-3550M | Recombinant Mouse Inpp5k Protein, Myc/DDK-tagged | +Inquiry |
INPP5K-2098R | Recombinant Rhesus Macaque INPP5K Protein, His (Fc)-Avi-tagged | +Inquiry |
INPP5K-5104H | Recombinant Human INPP5K Protein, GST-tagged | +Inquiry |
INPP5K-5448C | Recombinant Chicken INPP5K | +Inquiry |
INPP5K-3300H | Recombinant Human INPP5K protein, His-tagged | +Inquiry |
◆ Lysates | ||
INPP5K-5197HCL | Recombinant Human INPP5K 293 Cell Lysate | +Inquiry |
INPP5K-5196HCL | Recombinant Human INPP5K 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket