"NFATC3" Related Products

Recombinant Human NFATC3

Cat.No.: NFATC3-29252TH
Product Overview: Recombinant fragment corresponding to amino acids 70-149 of Human NFAT4 with an N terminal proprietary tag; Predicted MWt 34.43 kDa.
Description: The product of this gene is a member of the nuclear factors of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation and an inducible nuclear component. Other members of this family participate to form this complex also. The product of this gene plays a role in the regulation of gene expression in T cells and immature thymocytes. Several transcript variants encoding distinct isoforms have been identified for this gene.
Protein length: 80 amino acids
Molecular Weight: 34.430kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Isoform 1 is predominantly expressed in thymus and is also found in peripheral blood leukocytes and kidney. Isoform 2 is predominantly expressed in skeletal muscle and is also found in thymus, kidney, testis, spleen, prostate, ovary, small intestine, hear
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL
Sequence Similarities: Contains 1 RHD (Rel-like) domain.
Gene Name: NFATC3 nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3 [ Homo sapiens ]
Official Symbol: NFATC3
Synonyms: NFATC3; nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3; nuclear factor of activated T-cells, cytoplasmic 3; NFAT4; NFATX;
Gene ID: 4775
mRNA Refseq: NM_004555
Protein Refseq: NP_004546
MIM: 602698
Uniprot ID: Q12968
Chromosome Location: 16q22
Pathway: Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; B cell receptor signaling pathway, organism-specific biosystem; B cell receptor signaling pathway, conserved biosystem;
Function: DNA binding; chromatin binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.