"SYT5" Related Products

Recombinant Human SYT5, His-tagged

Cat.No.: SYT5-31493TH
Product Overview: Recombinant fragment, corresponding to amino acids 152-386 of Human Synaptotagmin V with N terminal His tag. MWt: ~28kDa,
Description: Synaptotagmins, such as SYT5, are a family of type III membrane proteins characterized by cytoplasmic repeats related to protein kinase C (see MIM 176960) regulatory (C2) domains, which are thought to bind calcium.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 96 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVL VMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWREL QAAPREEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLK KMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPY YNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAAGGAGLRHWADMLANPRRPIAQWHSLRPPDRVRLL PAP(Amino acid sequence (Sequence determined by 5 Sequencing))
Sequence Similarities: Belongs to the synaptotagmin family.Contains 2 C2 domains.
Gene Name: SYT5 synaptotagmin V [ Homo sapiens ]
Official Symbol: SYT5
Synonyms: SYT5; synaptotagmin V; synaptotagmin-5; synaptotagmin 5;
Gene ID: 6861
mRNA Refseq: NM_003180
Protein Refseq: NP_003171
MIM: 600782
Uniprot ID: O00445
Chromosome Location: 19q
Pathway: Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Regulation of Insulin Secretion, organism-specific biosystem;
Function: metal ion binding; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.