"TFF1" Related Products

Expand

Recombinant Human TFF1, His-tagged

Cat.No.: TFF1-27974TH
Product Overview: Recombinant full length Human Estrogen Inducible Protein pS2 with N terminal His tag; 81 amino acids with tag, Predicted MWt 9.0 kDa.
Description: Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer, and affect healing of the epithelium. This gene, which is expressed in the gastric mucosa, has also been studied because of its expression in human tumors. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.
Protein length: 60 amino acids
Conjugation: HIS
Molecular Weight: 9.000kDa inclusive of tags
Source: E. coli
Tissue specificity: Found in stomach, with highest levels in the upper gastric mucosal cells (at protein level). Detected in goblet cells of the small and large intestine and rectum, small submucosal glands in the esophagus, mucous acini of the sublingual gland, submucosal g
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, 0.1mM PMSF, pH 8.0
Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Sequence Similarities: Contains 1 P-type (trefoil) domain.
Gene Name: TFF1 trefoil factor 1 [ Homo sapiens ]
Official Symbol: TFF1
Synonyms: TFF1; trefoil factor 1; BCEI, breast cancer, estrogen inducible sequence expressed in; D21S21; HP1.A; HPS2; pNR 2; pS2;
Gene ID: 7031
mRNA Refseq: NM_003225
Protein Refseq: NP_003216
MIM: 113710
Uniprot ID: P04155
Chromosome Location: 21q22.3
Pathway: FOXA1 transcription factor network, organism-specific biosystem;
Function: growth factor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.