Recombinant Human TFF1 Protein (25-84 aa), His-tagged

• Cat.No.: TFF1-1537H
• Product Overview: Recombinant Human TFF1 Protein (25-84 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 25-84 aa
• Description: Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 8.7 kDa
• AA Sequence: EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: TFF1 trefoil factor 1 [ Homo sapiens ]
• Official Symbol: TFF1
• Synonyms: TFF1; D21S21; HP1.A; HPS2; pNR 2; pS2; protein pS2; polypeptide P1.A; BCEI; pNR-2
• Gene ID: 7031
• mRNA Refseq: NM_003225
• Protein Refseq: NP_003216
• MIM: 113710
• UniProt ID: P04155