Recombinant Human TFF1 Protein (25-84 aa), His-tagged
Cat.No. : | TFF1-1537H |
Product Overview : | Recombinant Human TFF1 Protein (25-84 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 25-84 aa |
Description : | Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 8.7 kDa |
AA Sequence : | EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TFF1 trefoil factor 1 [ Homo sapiens ] |
Official Symbol | TFF1 |
Synonyms | TFF1; D21S21; HP1.A; HPS2; pNR 2; pS2; protein pS2; polypeptide P1.A; BCEI; pNR-2; |
Gene ID | 7031 |
mRNA Refseq | NM_003225 |
Protein Refseq | NP_003216 |
MIM | 113710 |
UniProt ID | P04155 |
◆ Recombinant Proteins | ||
Tff1-1436M | Recombinant Mouse Tff1 protein, His & GST-tagged | +Inquiry |
Tff1-1437R | Recombinant Rat Tff1 protein, His & T7-tagged | +Inquiry |
TFF1-6417H | Recombinant Human TFF1 Protein (Met1-Phe84), N-His tagged | +Inquiry |
TFF1-27976TH | Recombinant Human TFF1 | +Inquiry |
TFF1-6028R | Recombinant Rat TFF1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TFF1-1127HCL | Recombinant Human TFF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TFF1 Products
Required fields are marked with *
My Review for All TFF1 Products
Required fields are marked with *