Recombinant Human TFF1 Protein (25-84 aa), His-tagged

Cat.No. : TFF1-1537H
Product Overview : Recombinant Human TFF1 Protein (25-84 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 25-84 aa
Description : Stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. May inhibit the growth of calcium oxalate crystals in urine.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 8.7 kDa
AA Sequence : EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name TFF1 trefoil factor 1 [ Homo sapiens ]
Official Symbol TFF1
Synonyms TFF1; D21S21; HP1.A; HPS2; pNR 2; pS2; protein pS2; polypeptide P1.A; BCEI; pNR-2;
Gene ID 7031
mRNA Refseq NM_003225
Protein Refseq NP_003216
MIM 113710
UniProt ID P04155

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TFF1 Products

Required fields are marked with *

My Review for All TFF1 Products

Required fields are marked with *

0
cart-icon