Recombinant Human CAV3 protein, Myc/DDK-tagged
Cat.No. : | CAV3-011H |
Product Overview : | Recombinant Human CAV3 protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Families: Druggable Genome, Transmembrane. Protein Pathways: Focal adhesion. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a caveolin family member, which functions as a component of the caveolae plasma membranes found in most cell types. Caveolin proteins are proposed to be scaffolding proteins for organizing and concentrating certain caveolin-interacting molecules. Mutations identified in this gene lead to interference with protein oligomerization or intra-cellular routing, disrupting caveolae formation and resulting in Limb-Girdle muscular dystrophy type-1C (LGMD-1C), hyperCKemia or rippling muscle disease (RMD). Alternative splicing has been identified for this locus, with inclusion or exclusion of a differentially spliced intron. In addition, transcripts utilize multiple polyA sites and contain two potential translation initiation sites. |
Source : | HEK293T |
Species : | Human |
Tag : | Myc/DDK |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.1 kDa |
AA Sequence : | myc-FLAG tag |
Product-Related Proteins : | TA50011-100 LC409590 TA350952 RC221140 |
Purity : | > 80% |
Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL |
Gene Name : | CAV3 caveolin 3 [ Homo sapiens (human) ] |
Official Symbol : | CAV3 |
Synonyms : | LGMD1C; LQT9; MPDT; RMD2; VIP-21; VIP21 |
Gene ID : | 859 |
mRNA Refseq : | NM_033337 |
Protein Refseq : | NP_203123 |
MIM : | 601253 |
UniProt ID : | P56539 |
Products Types
◆ Recombinant Protein | ||
CAV3-464R | Recombinant Rhesus Macaque CAV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAV3-812R | Recombinant Rat CAV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAV3-511H | Recombinant Human CAV3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAV3-633H | Recombinant Human CAV3 Protein, His&GST-tagged | +Inquiry |
Cav3-782M | Recombinant Mouse Cav3 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
CAV3-7819HCL | Recombinant Human CAV3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket