Recombinant Human NPPB therapeutic protein

• Cat.No.: NPPB-P029H
• Product Overview: Recombinant Human Natriuretic Peptide B therapeutic protein is a medication used to treat acutely decompensated congestive heart failure with dyspnea at rest or with minimal exertion (such as talk, eating or bathing). It is the recombinant form of the 32 amino acid human B-type natriuretic peptide, which is normally produced by the ventricular myocardium.

Specification

• Description: This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Mutations in this gene have been associated with postmenopausal osteoporosis. The expression product is the active ingredient of Natrecor and nesiritide.
• Species: Human
• Molecular Mass: 3464 Da
• Protein length: 32aa
• AA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Gene Information

• Gene Name: NPPB natriuretic peptide B [ Homo sapiens ]
• Official Symbol: NPPB
• Synonyms: NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP
• Gene ID: 4879
• mRNA Refseq: NM_002521
• Protein Refseq: NP_002512
• MIM: 600295
• UniProt ID: P16860
• Chromosome Location: 1p36.2
• Pathway: MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem
• Function: diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding