"NPPB" Related Products

Expand
Expand
Expand

Recombinant Human NPPB Protein, His-tagged

Cat.No.: NPPB-1409H
Product Overview: Recombinant Human Natriuretic Peptides B was expressed in E.coli expression system and the target gene encoding His27-His134 is expressed with a 6His tag at the N-terminus.
Source: E. coli
Species: Human
Tag : His
Form: Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 20% Glycerol, pH 7.4.
AA Sequence: MGSSHHHHHHSSGLVPRGSHMHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQES PRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Gene Name: NPPB natriuretic peptide B [ Homo sapiens ]
Official Symbol: NPPB
Synonyms: NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP;
Gene ID: 4879
mRNA Refseq: NM_002521
Protein Refseq: NP_002512
MIM: 600295
UniProt ID: P16860

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.