"sod1" Related Products

Expand
Expand

Recombinant Zebrafish sod1 Protein, His-SUMO/MYC-tagged

Cat.No.: sod1-1373Z
Product Overview: Recombinant Zebrafish sod1 Protein (1-154aa) was expressed in E. coli with N-terminal His-SUMO and C-terminal MYC tag.
Source: E. coli
Species: Zebrafish
Tag : His-SUMO/MYC
Form: Tris-based buffer, 50% glycerol.
Molecular Mass: 37.1 kDa
AA Sequence: MVNKAVCVLKGTGEVTGTVYFNQEGEKKPVKVTGEITGLTPGKHGFHVHAFGDNTNGCISAGPHFNPHDK
THGGPTDSVRHVGDLGNVTADASGVAKIEIEDAMLTLSGQHSIIGRTMVIHEKEDDLGKGGNEESLKTGN
AGGRLACGVIGITQ
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name: sod1 superoxide dismutase 1, soluble [ Danio rerio (zebrafish) ]
Official Symbol: sod1
Synonyms: ZSOD; cuzn; Cu/Zn-SOD; sod1
Gene ID: 30553
mRNA Refseq: NM_131294.1
Protein Refseq: NP_571369.1
UniProt ID: O73872

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.