"NPM1" Related Products

Expand
Expand
Expand

Recombinant Human Nucleophosmin (nucleolar phosphoprotein B23, numatrin), His-tagged

Cat. No.: NPM1-6799H
Product Overview: Recombinant humanNPM1 protein, fused to His-tag at N-terminus, was expressed in E.coli andpurified by using conventional chromatography techniques.
Description: NPM1 is aphosphoprotein which moves between the nucleus and the cytoplasm. It isthought to be involved in several processes including regulation of theARF/p53 pathway. A number of genes are fusion partners have beencharacterized, in particular the anaplastic lymphoma kinase gene onchromosome 2. Mutations in NPM1 are associated with acute myeloid leukemia
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 10% glycerol 0.15M NaCl,1mM DTT
Molecular Weight: 34.7kDa (314aa),confirmed by MALDI-TOF
Purity: > 85% by SDS -PAGE
Concentration: 0.5 mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MEDSMDMDMS PLRPQNYLFG CELKADKDYH FKVDNDENEH QLSLRTVSLG AGAKDELHIVEAEAMNYEGSPIKVTLATLK MSVQPTVSLG GFEITPPVVL RLKCGSGPVH ISGQHLVAVE EDAESEDEEEEDVKLLSISG KRSAPGGGSK VPQKKVKLAADEDDDDDDEE DDDEDDDDDD FDDEEAEEKA PVKKSIRDTPAKNAQKSNQN GKDSKPSSTP RSKGQESFKK QEKTPKTPKG PSSVEDIKAKMQASIEKGGS LPKVEAKFINYVKNCFRMTD QEAIQDLWQW RKSL
Storage: Can be stored at+4°C short term (1-2 weeks). For long term storage, aliquot and store at-20°C or -70°C. Avoid repeated freezing and thawing cycles.
Pathways: aurora B signaling; BARD1 signalingevents; chromosome Maintenance; deposition of New CENPA-containingNucleosomes at the Centromere; HIF-1-alpha transcription factor network; HIVInfection; host Interactions of HIV factors; interactions of Rev with hostcellular proteins; nuclear import of Rev protein; nucleosome assembly;validated targets of C-MYC transcriptional activation
Gene Name: NPM1 nucleophosmin (nucleolarphosphoprotein B23, numatrin) [ Homo sapiens ]
Official Symbol: NPM1
Synonyms: NPM1; nucleophosmin (nucleolarphosphoprotein B23, numatrin); B23; NPM; MGC104254; nucleophosmin; numatrin;OTTHUMP00000161024; OTTHUMP00000161025; OTTHUMP00000223397; OTTHUMP00000223398;nucleolar protein NO38; nucleophosmin/nucleoplasmin family, member 1
Gene ID: 4869
mRNA Refseq: NM_199185
Protein Refseq: NP_954654
MIM: 164040
UniProt ID: P06748
Chromosome Location: 5q35.1
Function: NF-kappaB binding; RNA binding; Tatprotein binding; histone binding; protein binding; protein heterodimerizationactivity; ribosomal large subunit binding; transcription coactivatoractivity; unfolded protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.