Recombinant Human NPM1 protein(21-130 aa), C-His-tagged

• Cat.No.: NPM1-2572H
• Product Overview: Recombinant Human NPM1 protein(P06748)(21-130 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-130 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: CELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEE

Gene Information

• Gene Name: NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ]
• Official Symbol: NPM1
• Synonyms: NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin; nucleolar protein NO38; nucleophosmin/nucleoplasmin family, member 1; MGC104254
• Gene ID: 4869
• mRNA Refseq: NM_001037738
• Protein Refseq: NP_001032827
• MIM: 164040
• UniProt ID: P06748