Recombinant Human NPM1 protein(21-130 aa), C-His-tagged
| Cat.No. : | NPM1-2572H |
| Product Overview : | Recombinant Human NPM1 protein(P06748)(21-130 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-130 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | CELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEE |
| Gene Name | NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ] |
| Official Symbol | NPM1 |
| Synonyms | NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin; nucleolar protein NO38; nucleophosmin/nucleoplasmin family, member 1; MGC104254; |
| Gene ID | 4869 |
| mRNA Refseq | NM_001037738 |
| Protein Refseq | NP_001032827 |
| MIM | 164040 |
| UniProt ID | P06748 |
| ◆ Recombinant Proteins | ||
| NPM1-4728H | Recombinant Human NPM1 Protein (Gly20-Lys154), N-His tagged | +Inquiry |
| NPM1-3805H | Recombinant Human NPM1 protein(Met9-Leu158), His-tagged | +Inquiry |
| NPM1-1417H | Recombinant Human NPM1, GST-tagged | +Inquiry |
| NPM1-7985HFL | Recombinant Full Length Human NPM1 protein, Flag-tagged | +Inquiry |
| NPM1-6819C | Recombinant Chicken NPM1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
| NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
| NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NPM1 Products
Required fields are marked with *
My Review for All NPM1 Products
Required fields are marked with *
