Recombinant Human NPM1 protein(21-130 aa), C-His-tagged
Cat.No. : | NPM1-2572H |
Product Overview : | Recombinant Human NPM1 protein(P06748)(21-130 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-130 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | CELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEE |
Gene Name | NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ] |
Official Symbol | NPM1 |
Synonyms | NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin; nucleolar protein NO38; nucleophosmin/nucleoplasmin family, member 1; MGC104254; |
Gene ID | 4869 |
mRNA Refseq | NM_001037738 |
Protein Refseq | NP_001032827 |
MIM | 164040 |
UniProt ID | P06748 |
◆ Recombinant Proteins | ||
NPM1-6799H | Recombinant Human Nucleophosmin (nucleolar phosphoprotein B23, numatrin), His-tagged | +Inquiry |
NPM1-4046R | Recombinant Rat NPM1 Protein | +Inquiry |
NPM1-27765TH | Recombinant Human NPM1 | +Inquiry |
NPM1-4728H | Recombinant Human NPM1 Protein (Gly20-Lys154), N-His tagged | +Inquiry |
NPM1-1607H | Recombinant Human NPM1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NPM1 Products
Required fields are marked with *
My Review for All NPM1 Products
Required fields are marked with *
0
Inquiry Basket