Recombinant Human NPM1 protein(21-130 aa), C-His-tagged

Cat.No. : NPM1-2572H
Product Overview : Recombinant Human NPM1 protein(P06748)(21-130 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-130 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : CELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEE
Gene Name NPM1 nucleophosmin (nucleolar phosphoprotein B23, numatrin) [ Homo sapiens ]
Official Symbol NPM1
Synonyms NPM1; nucleophosmin (nucleolar phosphoprotein B23, numatrin); nucleophosmin; B23; NPM; nucleolar phosphoprotein B23; nucleophosmin/nucleoplasmin family; member 1; numatrin; nucleolar protein NO38; nucleophosmin/nucleoplasmin family, member 1; MGC104254;
Gene ID 4869
mRNA Refseq NM_001037738
Protein Refseq NP_001032827
MIM 164040
UniProt ID P06748

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NPM1 Products

Required fields are marked with *

My Review for All NPM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon