Recombinant Mouse Npm1 Protein, His-SUMO-tagged
| Cat.No. : | Npm1-1297M |
| Product Overview : | Recombinant Mouse Npm1 Protein (1-292aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-292 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 48.6 kDa |
| AA Sequence : | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | Npm1 nucleophosmin 1 [ Mus musculus (house mouse) ] |
| Official Symbol | Npm1 |
| Synonyms | B23; Npm; NO38; Npm1 |
| Gene ID | 18148 |
| mRNA Refseq | NM_008722.3 |
| Protein Refseq | NP_032748.1 |
| UniProt ID | Q61937 |
| ◆ Recombinant Proteins | ||
| NPM1-7985HFL | Recombinant Full Length Human NPM1 protein, Flag-tagged | +Inquiry |
| Npm1-4474M | Recombinant Mouse Npm1 Protein, Myc/DDK-tagged | +Inquiry |
| NPM1-54H | Recombinant Human NPM1, His-tagged | +Inquiry |
| NPM1-135H | Recombinant Human NPM1 protein, MYC/DDK-tagged | +Inquiry |
| NPM1-6037H | Recombinant Human NPM1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
| NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
| NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Npm1 Products
Required fields are marked with *
My Review for All Npm1 Products
Required fields are marked with *
