Recombinant Mouse Npm1 Protein, His-SUMO-tagged
Cat.No. : | Npm1-1297M |
Product Overview : | Recombinant Mouse Npm1 Protein (1-292aa) was expressed in E. coli with N-terminal His-SUMO tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-292 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 48.6 kDa |
AA Sequence : | MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Npm1 nucleophosmin 1 [ Mus musculus (house mouse) ] |
Official Symbol | Npm1 |
Synonyms | B23; Npm; NO38; Npm1 |
Gene ID | 18148 |
mRNA Refseq | NM_008722.3 |
Protein Refseq | NP_032748.1 |
UniProt ID | Q61937 |
◆ Recombinant Proteins | ||
NPM1-134H | Recombinant Human NPM1 protein, MYC/DDK-tagged | +Inquiry |
NPM1-3705R | Recombinant Rat NPM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NPM1-27765TH | Recombinant Human NPM1 | +Inquiry |
NPM1-7985HFL | Recombinant Full Length Human NPM1 protein, Flag-tagged | +Inquiry |
NPM1-6819C | Recombinant Chicken NPM1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
NPM1-3738HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3739HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
NPM1-3737HCL | Recombinant Human NPM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Npm1 Products
Required fields are marked with *
My Review for All Npm1 Products
Required fields are marked with *
0
Inquiry Basket