Recombinant Mouse Npm1 Protein, His-SUMO-tagged

Cat.No. : Npm1-1297M
Product Overview : Recombinant Mouse Npm1 Protein (1-292aa) was expressed in E. coli with N-terminal His-SUMO tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&SUMO
Protein Length : 1-292 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 48.6 kDa
AA Sequence : MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEEDVKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVKKSVRDTPAKNAQKSNQNGKDLKPSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name Npm1 nucleophosmin 1 [ Mus musculus (house mouse) ]
Official Symbol Npm1
Synonyms B23; Npm; NO38; Npm1
Gene ID 18148
mRNA Refseq NM_008722.3
Protein Refseq NP_032748.1
UniProt ID Q61937

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Npm1 Products

Required fields are marked with *

My Review for All Npm1 Products

Required fields are marked with *

0
cart-icon
0
compare icon