"PTPRC" Related Products

Expand
Expand

Recombinant Human PTPRC, StrepII-tagged

Cat.No.: PTPRC-231H
Product Overview: Purified human recombinant CD45 or receptor-type tyrosine-protein phosphatase C protein (amino acids 24-575, 552 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 60.8 kDa. (Accession NP_002829.2; UniProt P08575)
Description: This product is the extracellular domain of CD45, a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling.
Source: Human Cells
Species: Human
Tag: StrepII
Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
Protein length: 24-575, 552 a.a.
AA Sequence: QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTG VSSVQTPHLPTHADSQTPSAGTDTQTFSGSAANAKLNPTPGSNAISDVPGERSTASTFPTDPVSPLTTTLSLAHH SSAALPARTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTA KLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKW KNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFGSPGEPQIIFC RSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAM CHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDY TFKAYFHNGDYPGEPFILHHSTSYNSK
Endotoxin: <0.1 eu per ug protein by lal
Purity: >95% pure by SDS-PAGE
Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.
Gene Name: PTPRC protein tyrosine phosphatase, receptor type, C [ Homo sapiens ]
Official Symbol: PTPRC
Synonyms: PTPRC; protein tyrosine phosphatase, receptor type, C; CD45; receptor-type tyrosine-protein phosphatase C; GP180; LCA; T200; CD45 antigen; T200 glycoprotein; leukocyte common antigen; leukocyte-common antigen; T200 leukocyte common antigen; protein tyrosine phosphatase, receptor type, c polypeptide; LY5; B220; L-CA; CD45R;
Gene ID: 5788
mRNA Refseq: NM_002838
Protein Refseq: NP_002829
MIM: 151460
UniProt ID: P08575
Chromosome Location: 1q31-q32
Pathway: Adaptive Immune System, organism-specific biosystem; Axon guidance, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; BCR signaling pathway, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem;
Function: hydrolase activity; protein binding; protein kinase binding; protein tyrosine phosphatase activity; receptor activity; transmembrane receptor protein tyrosine phosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.