Recombinant Human PTPRC protein(241-310 aa), C-His-tagged
Cat.No. : | PTPRC-2599H |
Product Overview : | Recombinant Human PTPRC protein(P08575)(241-310 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 241-310 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 10.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | YNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHD |
Gene Name | PTPRC protein tyrosine phosphatase, receptor type, C [ Homo sapiens ] |
Official Symbol | PTPRC |
Synonyms | PTPRC; protein tyrosine phosphatase, receptor type, C; CD45; receptor-type tyrosine-protein phosphatase C; GP180; LCA; T200; CD45 antigen; T200 glycoprotein; leukocyte common antigen; leukocyte-common antigen; T200 leukocyte common antigen; protein tyrosine phosphatase, receptor type, c polypeptide; LY5; B220; L-CA; CD45R; |
Gene ID | 5788 |
mRNA Refseq | NM_002838 |
Protein Refseq | NP_002829 |
MIM | 151460 |
UniProt ID | P08575 |
◆ Recombinant Proteins | ||
PTPRC-2599H | Recombinant Human PTPRC protein(241-310 aa), C-His-tagged | +Inquiry |
PTPRC-3253H | Recombinant Human PTPRC protein, His-tagged | +Inquiry |
Ptprc-4538MFL | Recombinant Full Length Mouse Ptprc, Flag-tagged | +Inquiry |
Ptprc-551M | Recombinant Mouse Ptprc(Gln26-Lys566) Protein, C-6*His-tagged | +Inquiry |
Ptprc-1203R | Recombinant Rat Ptprc Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTPRC-3045HCL | Recombinant Human PTPRC cell lysate | +Inquiry |
PTPRC-1141MCL | Recombinant Mouse PTPRC cell lysate | +Inquiry |
PTPRC-001MCL | Recombinant Mouse PTPRC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTPRC Products
Required fields are marked with *
My Review for All PTPRC Products
Required fields are marked with *