Recombinant Human PTPRC protein(241-310 aa), C-His-tagged

Cat.No. : PTPRC-2599H
Product Overview : Recombinant Human PTPRC protein(P08575)(241-310 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 241-310 aa
Form : 0.15 M Phosphate buffered saline
Molecular Mass : 10.5 kDa
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : YNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHD
Gene Name PTPRC protein tyrosine phosphatase, receptor type, C [ Homo sapiens ]
Official Symbol PTPRC
Synonyms PTPRC; protein tyrosine phosphatase, receptor type, C; CD45; receptor-type tyrosine-protein phosphatase C; GP180; LCA; T200; CD45 antigen; T200 glycoprotein; leukocyte common antigen; leukocyte-common antigen; T200 leukocyte common antigen; protein tyrosine phosphatase, receptor type, c polypeptide; LY5; B220; L-CA; CD45R;
Gene ID 5788
mRNA Refseq NM_002838
Protein Refseq NP_002829
MIM 151460
UniProt ID P08575

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTPRC Products

Required fields are marked with *

My Review for All PTPRC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon