"MIF" Related Products

Expand
Expand

Recombinant Human MIF, His-tagged N-Terminus

Cat. No.: MIF-24H
Product Overview: Recombinant human macrophage migration inhibitory factor (glycosylation-inhibiting factor), fused to His-tag at N-terminus, was cloned into anE. coliexpression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor is a single, non-glycosylated, polypeptide chain containing amino acids from 1-114 and having a molecular mass of 16.6 kDa.
Description: The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.
Source: Escherichia Coli.
Physical Appearance: 1mg/ml solution containing PBS pH-7.4.
Amino Acid Sequence: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPMFIVNTNV PRASVPDGFL SELTQQLAQA TGKPPQYIAV HVVPDQLMAF GGSSEPCALC LHSIGKIGGA QNRSYSKLLC GLLAERLRIS PDRVYINYYD MNAANVGWNN STFA.
Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Storage: Liquid MIF although stable 14℃ for 1 week, should be stored desiccated below -18℃. Please prevent freeze-thaw cycles.
Gene Name: MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens ]
Synonyms: MIF; macrophage migration inhibitory factor; GIF; GLIF; MMIF; phenylpyruvate tautomerase; glycosylation-inhibiting factor; EC 5.3.2.1; Glycosylation-inhibiting factor; Phenylpyruvate tautomerase
Gene ID: 4282
mRNA Refseq: NM_002415
Protein Refseq: NP_002406
MIM: 153620
UniProt ID: P14174
Chromosome Location: 22q11.23
Pathway: Phenylalanine metabolism; Tyrosine metabolism
Function: cytokine activity; dopachrome isomerase activity; isomerase activity; phenylpyruvate tautomerase activity;protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.