Recombinant Human MIF Protein
Cat.No. : | MIF-208H |
Product Overview : | Recombinant Human MIF Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Macrophage migration inhibitory factor (MIF) is a pro-inflammatory lymphokine that functions during cell-mediated immmunity. MIF promotes fibroblast migration by inducing interleukin 1 (IL-1), interleukin 8 (IL-8), and matrix metalloproteinase (MMP) expression. In interferon-gamma-activated macrophages, MIF stimulates nitric oxide (NO) production and tumor necrosis factor-alpha (TNF-α) secretion. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 12.5 kDa (115 aa) |
AA Sequence : | MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | MIF macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Homo sapiens (human) ] |
Official Symbol | MIF |
Synonyms | MIF; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GLIF; macrophage migration inhibitory factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; MMIF; |
Gene ID | 4282 |
mRNA Refseq | NM_002415 |
Protein Refseq | NP_002406 |
MIM | 153620 |
UniProt ID | P14174 |
◆ Recombinant Proteins | ||
MIF-218H | Recombinant Human MIF Protein (Met1-Ala115), C-His tagged, Animal-free, Carrier-free | +Inquiry |
MIF-198H | Recombinant Human MIF protein | +Inquiry |
MIF-4681H | Recombinant Human MIF Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MIF-5464H | Recombinant Human MIF protein, His-tagged | +Inquiry |
Mif-488R | Recombinant Rat Mif protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIF Products
Required fields are marked with *
My Review for All MIF Products
Required fields are marked with *
0
Inquiry Basket