Recombinant Mouse Mif Protein, His-tagged
Cat.No. : | Mif-125M |
Product Overview : | Purified recombinant protein of Mouse macrophage migration inhibitory factor (Mif) with C-terminal His tag, expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Pro-inflammatory cytokine. Involved in the innate immune response to bacterial pathogens. The expression of MIF at sites of inflammation suggests a role as mediator in regulating the function of macrophages in host defense. Counteracts the anti-inflammatory activity of glucocorticoids. Has phenylpyruvate tautomerase and dopachrome tautomerase activity (in vitro), but the physiological substrate is not known. It is not clear whether the tautomerase activity has any physiological relevance, and whether it is important for cytokine activity. |
Molecular Mass : | 13.4 kDa |
AA Sequence : | PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFALEHHHHHH |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4 |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Mif macrophage migration inhibitory factor (glycosylation-inhibiting factor) [ Mus musculus (house mouse) ] |
Official Symbol | Mif |
Synonyms | Mif; macrophage migration inhibitory factor (glycosylation-inhibiting factor); GIF; DER6; Glif; macrophage migration inhibitory factor; L-dopachrome isomerase; L-dopachrome tautomerase; delayed early response protein 6; phenylpyruvate tautomerase; EC 5.3.2.1; EC 5.3.3.12 |
Gene ID | 17319 |
mRNA Refseq | NM_010798 |
Protein Refseq | NP_034928 |
UniProt ID | P34884 |
◆ Recombinant Proteins | ||
Mif-648M | Recombinant Mouse Mif | +Inquiry |
MIF-033H | Recombinant Human MIF Protein | +Inquiry |
MIF-4551H | Recombinant Human MIF Protein (Met1-Ala115), C-His tagged | +Inquiry |
MIF-4550H | Recombinant Human MIF Protein (Met1-Ala115), N-His tagged | +Inquiry |
MIF-332M | Recombinant Human MIF Protein (115 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIF-1884MCL | Recombinant Mouse MIF cell lysate | +Inquiry |
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mif Products
Required fields are marked with *
My Review for All Mif Products
Required fields are marked with *