Recombinant Mouse MIF Protein

Cat.No. : MIF-209M
Product Overview : Recombinant Mouse MIF Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Macrophage migration inhibitory factor (MIF) is a pro-inflammatory lymphokine that functions during cell-mediated immmunity. MIF promotes fibroblast migration by inducing interleukin 1 (IL-1), interleukin 8 (IL-8), and matrix metalloproteinase (MMP) expression. In interferon-gamma-activated macrophages, MIF stimulates nitric oxide (NO) production and tumor necrosis factor alpha (TNF-α) secretion.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 12.5 kDa (115 aa)
AA Sequence : MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Mif macrophage migration inhibitory factor [ Mus musculus (house mouse) ]
Official Symbol MIF
Synonyms MIF; macrophage migration inhibitory factor; DER6; L-dopachrome isomerase; L-dopachrome tautomerase; phenylpyruvate tautomerase; glycosylation-inhibiting factor; delayed early response protein 6; GIF; Glif; MGC107654;
Gene ID 17319
mRNA Refseq NM_010798
Protein Refseq NP_034928
UniProt ID P34884

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIF Products

Required fields are marked with *

My Review for All MIF Products

Required fields are marked with *

0
cart-icon