"RB1" Related Products

Expand
Expand

Recombinant Human RB1 protein

Cat.No. : RB1-195H
Product Overview : Recombinant Human RB1 protein was expressed in Escherichia coli.
Description : Rb encoded by the RB1 gene in humans, is expressed by retina and belongs to the etinoblastoma-associated protein family. The hole protein consists of 928 a.a. and the rHuRb fragment occupies sequence of 792-929 a.a.. Rb is a key regulator of entry into cell division that acts as a tumor suppressor. It has many functions, for example, promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C, and acts as a transcription repressor of E2F1 target genes and so on. The rHuRb is the region that rich of modified residue like phosphothreonine and N6-acetyllysine.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass : Approximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
Protein length : 146
AA Sequence : MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEKHHHHHH
Endotoxin : Less than 1 EU/μg of rHuRb137, His as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : RB1
Official Symbol : RB1
Synonyms : RB1; retinoblastoma 1; OSRC, osteosarcoma; retinoblastoma-associated protein; RB; retinoblastoma suspectibility protein; pRb; OSRC; pp110; p105-Rb;
Gene ID : 5925
mRNA Refseq : NM_000321
Protein Refseq : NP_000312
MIM : 614041
UniProt ID : P06400

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.