Recombinant Rat NSF Protein (721-919 aa), His-tagged
Cat.No. : | RB1-1283R |
Product Overview : | Recombinant Rat NSF Protein (721-919 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 721-919 aa |
Description : | Key regulator of entry into cell division that acts as a tumor suppressor. Promotes G0-G1 transition when phosphorylated by CDK3/cyclin-C. Acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. Recruits and targets histone methyltransferases SUV39H1, SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. Controls histone H4 'Lys-20' trimethylation. Inhibits the intrinsic kinase activity of TAF1. Mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 26.6 kDa |
AA Sequence : | KDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGSDEADGSKHLPAESKFQQKLAEMTSTRTRMQKQKLNDSMEISNKEE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | Rb1 retinoblastoma 1 [ Rattus norvegicus ] |
Official Symbol | RB1 |
Synonyms | RB1; retinoblastoma 1; rb; pRb; pp105; |
Gene ID | 24708 |
mRNA Refseq | NM_017045 |
Protein Refseq | NP_058741 |
UniProt ID | P33568 |
◆ Recombinant Proteins | ||
RB1-31044TH | Recombinant Human RB1, His-tagged | +Inquiry |
RB1-195H | Recombinant Human RB1 protein | +Inquiry |
RB1-701H | Recombinant Human RB1, GST-tagged | +Inquiry |
RB1-6150H | Recombinant Human RB1 Protein (Gln639-Thr778), N-GST tagged | +Inquiry |
RB1-654H | Recombinant Human RB1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RB1 Products
Required fields are marked with *
My Review for All RB1 Products
Required fields are marked with *
0
Inquiry Basket