"SPARC" Related Products

Expand
Expand
Expand

Recombinant Human SPARC, His-tagged

Cat. No.: SPARC-210H
Product Overview: Recombinant Human Osteonectin fused with 6X His tag produced inE.Coliis a single, non-glycosylated, polypeptide chain containing 295 amino acids and having a molecular mass of 34 kDa. The BM40 is purified by proprietary chromatographic techniques.
Description: SPARC, an acronym for "secreted protein, acidic and rich in cysteine", is also known as osteonectin or BM-40. It is the founding member of a family of secreted matricellular proteins with similar domain structure. The 303 amino acid, 43 kDa protein contains a 17 aa signal sequence, an N-terminal acidic region that binds calcium, a follistatin domain containing Kazal-like sequences, and a C-terminal extracellular calcium (EC) binding domain with two EF-hand motifs. SPARC is produced by fibroblasts, capillary endothelial cells, platelets and macrophages, especially in areas of tissue morphogenesis and remodeling. SPARC shows context-specific effects, but generally inhibits adhesion, spreading and proliferation, and promotes collagen matrix formation. For endothelial cells, SPARC disrupts focal adhesions and binds and sequesters PDGF and VEGF. SPARC is abundantly expressed in bone, where it promotes osteoblast differentiation and inhibits adipogenesis.
Source: Escherichia Coli.
Amino Acid Sequence: MSYYHHHHHHPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: The SPARC (1 mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4.
Purity: Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Solubility: It is recommended to reconstitute the lyophilized SPARC in sterile 18MΩ-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Stability: Lyophilized Osteonectin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BM-40 should be stored at 4°Cbetween 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name: SPARC secreted protein, acidic, cysteine-rich (osteonectin) [ Homo sapiens ]
Synonyms: SPARC; secreted protein, acidic, cysteine-rich (osteonectin); ON; cysteine-rich protein; osteonectin; Basement-membrane protein 40; BM-40; Secreted protein acidic and rich in cysteine; secreted protein, acidic, cysteine-rich
Gene ID: 6678
mRNA Refseq: NM_003118
Protein Refseq: NP_003109
MIM: 182120
UniProt ID: P09486
Chromosome Location: 5q31-q33
Pathway: Hemostasis
Function: calcium ion binding; collagen binding; copper ion binding; extracellular matrix binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.