Recombinant Mouse Sparc Protein, His-tagged

Cat.No. : Sparc-010M
Product Overview : Recombinant Mouse Sparc Protein (18-302aa) with His tag was expressed in insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 18-302aa
Description : Broad expression in subcutaneous fat pad adult (RPKM 1043.9), bladder adult (RPKM 893.4) and 22 other tissues.
Form : Liquid
Molecular Mass : 33.3kDa (291aa)
AA Sequence : APQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI
Endotoxin : < 1 EU per 1 µg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.25 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name Sparc secreted acidic cysteine rich glycoprotein [ Mus musculus (house mouse) ]
Official Symbol Sparc
Synonyms Sparc; secreted acidic cysteine rich glycoprotein; ON; BM-40; SPARC; basement-membrane protein 40; osteonectin; secreted protein acidic and rich in cysteine
Gene ID 20692
mRNA Refseq NM_009242
Protein Refseq NP_033268
UniProt ID P07214

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Sparc Products

Required fields are marked with *

My Review for All Sparc Products

Required fields are marked with *

0
cart-icon