Recombinant Mouse Sparc Protein, His-tagged
| Cat.No. : | Sparc-010M |
| Product Overview : | Recombinant Mouse Sparc Protein (18-302aa) with His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Insect Cells |
| Tag : | His |
| Protein Length : | 18-302aa |
| Description : | Broad expression in subcutaneous fat pad adult (RPKM 1043.9), bladder adult (RPKM 893.4) and 22 other tissues. |
| Form : | Liquid |
| Molecular Mass : | 33.3kDa (291aa) |
| AA Sequence : | APQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI |
| Endotoxin : | < 1 EU per 1 µg of protein (determined by LAL method) |
| Purity : | > 95% by SDS-PAGE |
| Applications : | SDS-PAGE |
| Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
| Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
| Storage Buffer : | In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
| Gene Name | Sparc secreted acidic cysteine rich glycoprotein [ Mus musculus (house mouse) ] |
| Official Symbol | Sparc |
| Synonyms | Sparc; secreted acidic cysteine rich glycoprotein; ON; BM-40; SPARC; basement-membrane protein 40; osteonectin; secreted protein acidic and rich in cysteine |
| Gene ID | 20692 |
| mRNA Refseq | NM_009242 |
| Protein Refseq | NP_033268 |
| UniProt ID | P07214 |
| ◆ Recombinant Proteins | ||
| SPARC-4111H | Recombinant Human SPARC Protein, His (Fc)-Avi-tagged | +Inquiry |
| Sparc-010M | Recombinant Mouse Sparc Protein, His-tagged | +Inquiry |
| SPARC-5254H | Recombinant Human SPARC protein, GST-tagged | +Inquiry |
| SPARC-5683R | Recombinant Rat SPARC Protein | +Inquiry |
| Sparc-7698M | Recombinant Mouse Sparc protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| SPARC-287B | Native Bovine Osteonectin | +Inquiry |
| SPARC-30653TH | Native Human SPARC | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPARC-2616HCL | Recombinant Human SPARC cell lysate | +Inquiry |
| SPARC-2120MCL | Recombinant Mouse SPARC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Sparc Products
Required fields are marked with *
My Review for All Sparc Products
Required fields are marked with *
