Recombinant Mouse Sparc Protein, His-tagged
Cat.No. : | Sparc-010M |
Product Overview : | Recombinant Mouse Sparc Protein (18-302aa) with His tag was expressed in insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 18-302aa |
Description : | Broad expression in subcutaneous fat pad adult (RPKM 1043.9), bladder adult (RPKM 893.4) and 22 other tissues. |
Form : | Liquid |
Molecular Mass : | 33.3kDa (291aa) |
AA Sequence : | APQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEETVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYERDEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDLVI |
Endotoxin : | < 1 EU per 1 µg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.25 mg/mL (determined by Absorbance at 280nm) |
Storage Buffer : | In Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | Sparc secreted acidic cysteine rich glycoprotein [ Mus musculus (house mouse) ] |
Official Symbol | Sparc |
Synonyms | Sparc; secreted acidic cysteine rich glycoprotein; ON; BM-40; SPARC; basement-membrane protein 40; osteonectin; secreted protein acidic and rich in cysteine |
Gene ID | 20692 |
mRNA Refseq | NM_009242 |
Protein Refseq | NP_033268 |
UniProt ID | P07214 |
◆ Recombinant Proteins | ||
SPARC-31437TH | Active Recombinant Human SPARC Protein, Tag Free | +Inquiry |
SPARC-6343H | Recombinant Human SPARC Protein (Ala18-Ile303), N-His tagged | +Inquiry |
Sparc-010M | Recombinant Mouse Sparc Protein, His-tagged | +Inquiry |
Sparc-8608M | Recombinant Mouse Sparc Protein, His (Fc)-Avi-tagged | +Inquiry |
SPARC-30655TH | Recombinant Human SPARC, T7 -tagged | +Inquiry |
◆ Native Proteins | ||
SPARC-30653TH | Native Human SPARC | +Inquiry |
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPARC-2120MCL | Recombinant Mouse SPARC cell lysate | +Inquiry |
SPARC-2616HCL | Recombinant Human SPARC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sparc Products
Required fields are marked with *
My Review for All Sparc Products
Required fields are marked with *
0
Inquiry Basket