"CTF1" Related Products

Expand

Recombinant Human CTF1 protein

Cat.No. : CTF1-138H
Product Overview : Recombinant Human CTF1 protein was expressed in Escherichia coli.
Description : Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, leukemia inhibitory factor (LIF), oncostatin M (OSM), and ciliary neurotrophic factor (CNTF)[Pennica, 1996 #1320]. CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung. Studies showed CT-1 which induces cardiac myocyte hypertrophy in vitro can bind to and activate the ILST/gp130 receptor. Human CT-1 encodes a 201 amino acid (a.a.) residue protein that lacks a hydrophobic signal peptide and it shares 78 % a.a. and 80 % a.a. sequence identity with murine and rat CT-1.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 1.0 ng/ml, corresponding to a specific activity of > 1.0× 106 IU/mg.
Molecular Mass : Approximately 21.2 kDa, a single non-glycosylated polypeptide chain containing 201 amino acids.
Protein length : 201
AA Sequence : MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Endotoxin : Less than 0.1 EU/µg of rHuCT-1 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : CTF1
Official Symbol : CTF1
Synonyms : CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1;
Gene ID : 1489
mRNA Refseq : NM_001142544
Protein Refseq : NP_001136016
MIM : 600435
UniProt ID : Q16619

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.