Species : |
Mouse |
Source : |
HEK293 |
Protein Length : |
202 |
Description : |
Cardiotrophin-1 (CT-1) is a member of the cytokine family which also includes IL-6, IL-11, leukemia inhibitory factor (LIF), oncostatin M (OSM), and ciliary neurotrophic factor (CNTF). CT-1 is associated with the pathophysiology of several types of heart disease including hypertension, myocardial infarction, valvular heart disease, and congestive heart failure. The protein exerts its cellular effects by interacting with the glycoprotein 130 (gp130)/leukemia inhibitory factor receptor beta (LIFR) heterodimer. CT-1 activates phosphatidylinositol 3-kinase (PI-3 kinase) in cardiac myocytes and enhances transcription factor NF-κB DNA -binding activities. CT-1 is highly expressed in the heart, skeletal muscle, prostate and ovary and to lower levels in lung, kidney, pancreas, thymus, testis and small intestine. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
The EC50 value of Mouse Cardiotrophin-1 determined by the dose-dependent proliferation of TF-1 cells was ≤ 1.25 ng/mL, corresponding to a specific activity of ≥ 0.86 units/mg. |
Molecular Mass : |
22~27 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE. |
Storage : |
Lyophilized recombinant Mouse Cardiotrophin-1 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse Cardiotrophin-1 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |