Recombinant Human CTF1 Protein, GST-tagged
Cat.No. : | CTF1-2067H |
Product Overview : | Human CTF1 full-length ORF (NP_001321.1, 1 a.a. - 201 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008] |
Molecular Mass : | 47.6 kDa |
AA Sequence : | MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTF1 cardiotrophin 1 [ Homo sapiens ] |
Official Symbol | CTF1 |
Synonyms | CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1; |
Gene ID | 1489 |
mRNA Refseq | NM_001142544 |
Protein Refseq | NP_001136016 |
MIM | 600435 |
UniProt ID | Q16619 |
◆ Recombinant Proteins | ||
CTF1-238H | Active Recombinant Human CTF1 protein(Ser2-Ala201) | +Inquiry |
CTF1-251H | Recombinant Human CTF1, StrepII-tagged | +Inquiry |
CTF1-122H | Active Recombinant Human CTF1 protein | +Inquiry |
CTF1-2276HF | Recombinant Full Length Human CTF1 Protein, GST-tagged | +Inquiry |
CTF1-137H | Recombinant Human CTF1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTF1-001HCL | Recombinant Human CTF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTF1 Products
Required fields are marked with *
My Review for All CTF1 Products
Required fields are marked with *