Active Recombinant Mouse Ctf1 Protein
Cat.No. : | Ctf1-049M |
Product Overview : | Purified recombinant protein of Mouse cardiotrophin 1 (Ctf1) without tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Induces cardiac myocyte hypertrophy in vitro. Binds to and activates the ILST/gp130 receptor. |
Bio-activity : | The ED50 as determined by the dose-dependent proliferation of TF-1 cells was < 1.0 ng/ml, corresponding to a specific activity of > 1 x 10^6 units/mg. |
Molecular Mass : | 21.3 kDa |
AA Sequence : | SQREGSLEDHQTDSSISFLPHLEAKIRQTHNLARLLTKYAEQLLEEYVQQQGEPFGLPGFSPPRLPLAGLSGPAPSHAGLPVSERLRQDAAALSVLPALLDAVRRRQAELNPRAPRLLRSLEDAARQVRALGAAVETVLAALGAAARGPGPEPVTVATLFTANSTAGIFSAKVLGFHVCGLYGEWVSRTEGDLGQLVPGGVA |
Endotoxin : | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Purity : | >95%, as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Reconstitution : | Resuspend the protein in the desired concentration in proper buffer. |
Gene Name | Ctf1 cardiotrophin 1 [ Mus musculus (house mouse) ] |
Official Symbol | Ctf1 |
Synonyms | Ctf1; cardiotrophin 1; CT-1; cardiotrophin-1 |
Gene ID | 13019 |
mRNA Refseq | NM_007795 |
Protein Refseq | NP_031821 |
UniProt ID | Q60753 |
◆ Recombinant Proteins | ||
Ctf1-1286M | Recombinant Mouse Ctf1 Protein, His-tagged | +Inquiry |
CTF1-239H | Recombinant Human CTF1 protein(Ser2-Ala201), hFc-tagged | +Inquiry |
Ctf1-049M | Active Recombinant Mouse Ctf1 Protein | +Inquiry |
Ctf1-183M | Recombinant Murine Cardiotrophin 1 | +Inquiry |
CTF1-138H | Recombinant Human CTF1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTF1-001HCL | Recombinant Human CTF1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ctf1 Products
Required fields are marked with *
My Review for All Ctf1 Products
Required fields are marked with *