Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human FBLN2

Cat.No. : FBLN2-28902TH
Product Overview : Recombinant fragment of Human Fibulin 2 (aa 1076-1184) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes an extracellular matrix protein, which belongs to the fibulin family. This protein binds various extracellular ligands and calcium. It may play a role during organ development, in particular, during the differentiation of heart, skeletal and neuronal structures. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length : 109 amino acids
Molecular Weight : 37.620kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGD TIALNIIKGNEEGYFGTRRLNAYTGVVYLQRAVLEPRDFA LDVEMKLWRQGSVTTFLAKMHIFFTTFAL
Sequence Similarities : Belongs to the fibulin family.Contains 3 anaphylatoxin-like domains.Contains 11 EGF-like domains.
Gene Name : FBLN2 fibulin 2 [ Homo sapiens ]
Official Symbol : FBLN2
Synonyms : FBLN2; fibulin 2; fibulin-2;
Gene ID : 2199
mRNA Refseq : NM_001004019
Protein Refseq : NP_001004019
MIM : 135821
Uniprot ID : P98095
Chromosome Location : 3p25-p24
Function : calcium ion binding; extracellular matrix structural constituent;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends