"FBLN2" Related Products

Recombinant Human FBLN2

Cat.No. : FBLN2-28902TH
Product Overview : Recombinant fragment of Human Fibulin 2 (aa 1076-1184) with a N terminal proprietary tag: predicted molecular weight 37.62 kDa.
Description : This gene encodes an extracellular matrix protein, which belongs to the fibulin family. This protein binds various extracellular ligands and calcium. It may play a role during organ development, in particular, during the differentiation of heart, skeletal and neuronal structures. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length : 109 amino acids
Molecular Weight : 37.620kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Component of both basement membranes and other connective tissues. Expressed in heart, placenta and ovary.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FLECQNSPARITHYQLNFQTGLLVPAHIFRIGPAPAFTGD TIALNIIKGNEEGYFGTRRLNAYTGVVYLQRAVLEPRDFA LDVEMKLWRQGSVTTFLAKMHIFFTTFAL
Sequence Similarities : Belongs to the fibulin family.Contains 3 anaphylatoxin-like domains.Contains 11 EGF-like domains.
Gene Name : FBLN2 fibulin 2 [ Homo sapiens ]
Official Symbol : FBLN2
Synonyms : FBLN2; fibulin 2; fibulin-2;
Gene ID : 2199
mRNA Refseq : NM_001004019
Protein Refseq : NP_001004019
MIM : 135821
Uniprot ID : P98095
Chromosome Location : 3p25-p24
Function : calcium ion binding; extracellular matrix structural constituent;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.