Recombinant Human GSTA3, GST-tagged
Cat.No. : | GSTA3-27543TH |
Product Overview : | Recombinant full length Human GSTA3 with N terminal proprietary tag. Predicted MW 50.53 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined. |
Protein length : | 222 amino acids |
Conjugation : | GST |
Molecular Weight : | 50.530kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAED LGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYN LYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISL VELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQP GSPRKPPADAKALEEARKIFRF |
Sequence Similarities : | Belongs to the GST superfamily. Alpha family.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain. |
Gene Name : | GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ] |
Official Symbol : | GSTA3 |
Synonyms : | GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3; |
Gene ID : | 2940 |
mRNA Refseq : | NM_000847 |
Protein Refseq : | NP_000838 |
MIM : | 605449 |
Uniprot ID : | Q16772 |
Chromosome Location : | 6p12.2 |
Pathway : | Biological oxidations, organism-specific biosystem; Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Glutathione conjugation, organism-specific biosystem; Glutathione metabolism, organism-specific biosystem; |
Function : | glutathione transferase activity; glutathione transferase activity; glutathione transferase activity; transferase activity; |
Products Types
◆ Recombinant Protein | ||
GSTA3-317C | Recombinant Cynomolgus Monkey GSTA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA3-1809R | Recombinant Rhesus Macaque GSTA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA3-3968M | Recombinant Mouse GSTA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTA3-2462H | Recombinant Human GSTA3 Protein, MYC/DDK-tagged | +Inquiry |
GSTA3-754C | Recombinant Chicken GSTA3 protein, His & T7-tagged | +Inquiry |
◆ Lysates | ||
GSTA3-758HCL | Recombinant Human GSTA3 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket