"TCN1" Related Products

Recombinant Human TCN1

Cat.No.: TCN1-27949TH
Product Overview: Recombinant fragment corresponding to aa 1-424 Human TCN1 with N-terminal proprietary tag.Mol Wt 72.27 kDa inclusive of tag.
Description: This gene encodes a member of the vitamin B12-binding protein family. This family of proteins, alternatively referred to as R binders, is expressed in various tissues and secretions. This protein is a major constituent of secondary granules in neutrophils and facilitates the transport of cobalamin into cells.
Protein length: 424 amino acids
Molecular Weight: 72.270kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Neutrophil granule protein.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MRQSHQLPLVGLLLFSFIPSQLCEICEVSEENYIRLKPLL NTMIQSNYNRGTSAVNVVLSLKLVGIQIQTLMQKMIQQIK YNVKSRLSDVSSGELALIILALGVCRNAEENLIYDYHLID KLENKFQAEIENMEAHNGTPLTNYYQLSLDVLALCLFNGN YSTAEVVNHFTPENKNYYFGSQFSVDTGAMAVLALTCVKK SLINGQIKADEGSLKNISIYTKSLVEKILSEKKENGLIGN TFSTGEAMQALFVSSDYYNENDWNCRQTLNTVLTEISQGA FSNPNAAAQVLPALMGKTFLDINKDSSCVPASGNFNISAD EPITVTPPDSQSYISVDYSVRINETYFTNVAVLNGSVFLS VMEKAQKMNDTIFGFTMEERSWGPYITCIQGLCANNNDRT YWELLSGGEPLSQGAGSYVVRNG
Sequence Similarities: Belongs to the eukaryotic cobalamin transport proteins family.
Gene Name: TCN1 transcobalamin I (vitamin B12 binding protein, R binder family) [ Homo sapiens ]
Official Symbol: TCN1
Synonyms: TCN1; transcobalamin I (vitamin B12 binding protein, R binder family); transcobalamin-1; haptocorin; haptocorrin; TC1; TCI;
Gene ID: 6947
mRNA Refseq: NM_001062
Protein Refseq: NP_001053
MIM: 189905
Uniprot ID: P20061
Chromosome Location: 11q11-q12
Function: cobalamin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.