Recombinant Pig TCN1 Protein (25-416 aa), His-tagged
Cat.No. : | TCN1-1534P |
Product Overview : | Recombinant Pig TCN1 Protein (24-433 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | Yeast |
Tag : | His |
Protein Length : | 25-416 aa |
Description : | Binds vitamin B12 with ftomolar affinity and protects it from the acidic environment of the stomach . Binds to cobalamin and to cobalamin analogs such as cobinamide. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 46.3 kDa |
AA Sequence : | CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | TCN1 transcobalamin I (vitamin B12 binding protein, R binder family) [ Sus scrofa ] |
Official Symbol | TCN1 |
Synonyms | TCN1; transcobalamin I (vitamin B12 binding protein, R binder family); |
Gene ID | 396873 |
UniProt ID | P17630 |
◆ Recombinant Proteins | ||
TCN1-1534P | Recombinant Pig TCN1 Protein (25-416 aa), His-tagged | +Inquiry |
TCN1-1533H | Recombinant Human TCN1 Protein (24-433 aa), His-tagged | +Inquiry |
TCN1-632H | Recombinant Human TCN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TCN1-3554H | Recombinant Human TCN1 protein, His-SUMO-tagged | +Inquiry |
TCN1-569H | Recombinant Human TCN1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCN1-1171HCL | Recombinant Human TCN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TCN1 Products
Required fields are marked with *
My Review for All TCN1 Products
Required fields are marked with *
0
Inquiry Basket