Recombinant Pig TCN1 protein, His-tagged
Cat.No. : | TCN1-2398P |
Product Overview : | Recombinant Pig TCN1 protein(P17630)(25-416aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pig |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-416aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 48.3 kDa |
AA Sequence : | CVVSEKDYSHLRLLISAMDNLEQIRGIYGASILLSQRLAGIQNPSLEEELSQRIQDDMNRRDMSNLTSGQLALIILAFGACKTPDVRFIHDHHLVEKLGEKFKEEIKNMEIHNSNPLTNYYQLSFDVLTLCLFRGNYSISNVTHYFNPENKNFNLSGHFSVDTGAVAVLALTCVKRSISNGKIKAAIKDSDTIQKYIESLVHKIQSEKMVVSLETRIAQEKLCRLSLSHQTITKMNQIAKKLWTRCLTHSQGVFRLPIAAAQILPALLGKTYLDVTKLLLVPKVQVNITDEPVPVVPTLSPENISVIYCVKINEISNCINITVFLDVMKAAQEKNSTIYGFTMTETPWGPYITSVQGIWANNNERTYWEHSEQQQITKPRSMGIMLSKMESI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TCN1 transcobalamin I (vitamin B12 binding protein, R binder family) [ Sus scrofa ] |
Official Symbol | TCN1 |
Synonyms | TCN1; transcobalamin I (vitamin B12 binding protein, R binder family); |
Gene ID | 396873 |
◆ Recombinant Proteins | ||
TCN1-569H | Recombinant Human TCN1 Protein, His-tagged | +Inquiry |
TCN1-27949TH | Recombinant Human TCN1 | +Inquiry |
TCN1-1533H | Recombinant Human TCN1 Protein (24-433 aa), His-tagged | +Inquiry |
TCN1-3554H | Recombinant Human TCN1 protein, His-SUMO-tagged | +Inquiry |
TCN1-632H | Recombinant Human TCN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCN1-1171HCL | Recombinant Human TCN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TCN1 Products
Required fields are marked with *
My Review for All TCN1 Products
Required fields are marked with *
0
Inquiry Basket