"ZBTB48" Related Products

Expand

Recombinant Human ZBTB48, His-tagged

Cat.No.: ZBTB48-31650TH
Product Overview: Recombinant fragment, corresponding to amino acids 390-688 of Human ZBTB48 with an N terminal His tag; Predicted MWt 35 kDa.
Description: ZBTB48 contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to and regulates the J and/or S elements in MHC II promoter.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 109 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KKDLQSHMIKLHGAPKPHACPTCAKCFLSRTELQLHEAFK HRGEKLFVCEECGHRASSRNGLQMHIKAKHRNERPHVC EFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQ ASLDKHNRTHTGERPFSCEFCEQRFTEKGPLLRHVASR HQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTEC GYKFTRQAHLRRHMEIHDRVENYNPRQRKLRNLIIEDE KMVVVALQPPAELEVGSAEVIVESLAQGGLASQLPGQR LCAEESFTGPGVLEPSLIITAAVPEDCDT
Gene Name: ZBTB48 zinc finger and BTB domain containing 48 [ Homo sapiens ]
Official Symbol: ZBTB48
Synonyms: ZBTB48; zinc finger and BTB domain containing 48; GLI Kruppel family member HKR3 , HKR3; zinc finger and BTB domain-containing protein 48; ZNF855;
Gene ID: 3104
mRNA Refseq: NM_005341
Protein Refseq: NP_005332
MIM: 165270
Uniprot ID: P10074
Chromosome Location: 1p36.3
Function: DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.