Recombinant Human ZBTB48 protein, His-tagged
| Cat.No. : | ZBTB48-3784H |
| Product Overview : | Recombinant Human ZBTB48 protein(1-293 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-293 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEPAENRKGTAVPVEC |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ZBTB48 zinc finger and BTB domain containing 48 [ Homo sapiens ] |
| Official Symbol | ZBTB48 |
| Synonyms | ZBTB48; zinc finger and BTB domain containing 48; GLI Kruppel family member HKR3 , HKR3; zinc finger and BTB domain-containing protein 48; ZNF855; zinc finger protein 855; GLI-Kruppel family member HKR3; krueppel-related zinc finger protein 3; HKR3; pp9964; |
| Gene ID | 3104 |
| mRNA Refseq | NM_005341 |
| Protein Refseq | NP_005332 |
| MIM | 165270 |
| UniProt ID | P10074 |
| ◆ Recombinant Proteins | ||
| ZBTB48-31650TH | Recombinant Human ZBTB48, His-tagged | +Inquiry |
| ZBTB48-3434C | Recombinant Chicken ZBTB48 | +Inquiry |
| ZBTB48-3785H | Recombinant Human ZBTB48 protein, GST-tagged | +Inquiry |
| ZBTB48-627HF | Recombinant Full Length Human ZBTB48 Protein, GST-tagged | +Inquiry |
| ZBTB48-3784H | Recombinant Human ZBTB48 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZBTB48-213HCL | Recombinant Human ZBTB48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB48 Products
Required fields are marked with *
My Review for All ZBTB48 Products
Required fields are marked with *
