Recombinant Human ZBTB48 protein, GST-tagged
| Cat.No. : | ZBTB48-3785H |
| Product Overview : | Recombinant Human ZBTB48(1 a.a. - 688 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1 a.a. - 688 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 103.5 kDa |
| AA Sequence : | MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGL LLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEE EEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQ GGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEPAENRKGTAVPVECPTCHKKF LSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRVHMVSHTGE MPYKCSSCSQQFMQKKDLQSHMIKLHGAPKPHACPTCAKCFLSRTELQLHEAFKHRGEKLFVCEECGHRASSRNG LQMHIKAKHRNERPHVCEFCSHAFTQKANLNMHLRTHTGEKPFQCHLCGKTFRTQASLDKHNRTHTGERPFSCEF CEQRFTEKGPLLRHVASRHQEGRPHFCQICGKTFKAVEQLRVHVRRHKGVRKFECTECGYKFTRQAHLRRHMEIH DRVENYNPRQRKLRNLIIEDEKMVVVALQPPAELEVGSAEVIVESLAQGGLASQLPGQRLCAEESFTGPGVLEPS LIITAAVPEDCDT |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | ZBTB48 zinc finger and BTB domain containing 48 [ Homo sapiens ] |
| Official Symbol | ZBTB48 |
| Synonyms | ZBTB48; zinc finger and BTB domain containing 48; GLI Kruppel family member HKR3 , HKR3; zinc finger and BTB domain-containing protein 48; ZNF855; zinc finger protein 855; GLI-Kruppel family member HKR3; krueppel-related zinc finger protein 3; HKR3; pp9964; |
| Gene ID | 3104 |
| mRNA Refseq | NM_005341 |
| Protein Refseq | NP_005332 |
| MIM | 165270 |
| UniProt ID | P10074 |
| Chromosome Location | 1p36.3 |
| Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| ZBTB48-3784H | Recombinant Human ZBTB48 protein, His-tagged | +Inquiry |
| ZBTB48-31650TH | Recombinant Human ZBTB48, His-tagged | +Inquiry |
| ZBTB48-3434C | Recombinant Chicken ZBTB48 | +Inquiry |
| ZBTB48-627HF | Recombinant Full Length Human ZBTB48 Protein, GST-tagged | +Inquiry |
| ZBTB48-3785H | Recombinant Human ZBTB48 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ZBTB48-213HCL | Recombinant Human ZBTB48 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ZBTB48 Products
Required fields are marked with *
My Review for All ZBTB48 Products
Required fields are marked with *
