Recombinant Domestic water buffalo Lingual protein, His-KSI-tagged
Cat.No. : | Lingual-4275D |
Product Overview : | Recombinant Domestic water buffalo Lingual protein(A3RJ36)(25-64aa), fused to N-terminal His-KSI tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Domestic water buffalo |
Tag : | His-KSI |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.8 kDa |
Protein length : | 25-64aa |
AA Sequence : | VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All Lingual Products
Required fields are marked with *
My Review for All Lingual Products
Required fields are marked with *
0
Inquiry Basket