Recombinant Human INS therapeutic protein
Cat.No. : | Insulin-P057H |
Product Overview : | Insulin glargine is produced by recombinant DNA technology using a non-pathogenic laboratory strain of Escherichia coli (K12) as the production organism. It is an analogue of human insulin made by replacing the asparagine residue at position A21 of the A-chain with glycine and adding two arginines to the C-terminus (positions B31 and 32) of the B-chain. The resulting protein is soluble at pH 4 and forms microprecipitates at physiological pH 7.4. Small amounts of insulin glargine are slowly released from microprecipitates giving the drug a long duration of action (up to 24 hours) and no pronounced peak concentration. |
- Specification
- Gene Information
- Related Products
Description : | After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants. |
Source : | E. coli |
Species : | Human |
Molecular Mass : | 60.6 Kda |
Protein length : | 32aa |
AA Sequence : | FVNQHLCGSHLVEALYLVCGERGFFYTPKTRR |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Gene Name : | INS insulin [ Homo sapiens ] |
Official Symbol : | INS |
Synonyms : | INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10; |
Gene ID : | 3630 |
mRNA Refseq : | NM_000207 |
Protein Refseq : | NP_000198 |
UniProt ID : | P01308 |
Chromosome Location : | 11p15.5 |
Pathway : | ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
Function : | hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
INS-856H | Recombinant Human INS Protein, His-tagged | +Inquiry |
INS-1187H | Recombinant Human INS Protein, His (Fc)-Avi-tagged | +Inquiry |
INS-369C | Recombinant Cynomolgus Monkey INS Protein, His (Fc)-Avi-tagged | +Inquiry |
INS-2689C | Recombinant Chicken INS Protein, His-tagged | +Inquiry |
INS-14H | Active Recombinant Human Insulin, Low Endotoxin, Media Grade | +Inquiry |
◆ Native Protein | ||
INS-5435B | Native Bovine Insulin | +Inquiry |
INS-512D | Native Bovine INS | +Inquiry |
◆ Lysates | ||
INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket