"INS" Related Products

Recombinant Human INS Protein, His-tagged

Cat.No.: INS-856H
Product Overview: Recombinant Human INS fused with His tag at the N-terminus was produced in E. coli.
Description: After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
Source: E. coli
Species: Human
Tag : His
Form: PBS, pH 7.4
AA sequence: HHHHHHFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS
Gene Name: INS insulin [ Homo sapiens ]
Official Symbol: INS
Synonyms: INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10;
Gene ID: 3630
mRNA Refseq: NM_000207
Protein Refseq: NP_000198
UniProt ID: P01308

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.