Recombinant Human INS Protein, His-tagged

Cat.No. : INS-856H
Product Overview : Recombinant Human INS fused with His tag at the N-terminus was produced in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
Form : PBS, pH 7.4
AA sequence : HHHHHHFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS
Gene Name INS insulin [ Homo sapiens ]
Official Symbol INS
Synonyms INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10;
Gene ID 3630
mRNA Refseq NM_000207
Protein Refseq NP_000198
UniProt ID P01308

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INS Products

Required fields are marked with *

My Review for All INS Products

Required fields are marked with *

0
cart-icon
0
compare icon