Cat.No.:	INS-856H
Product Overview:	Recombinant Human INS fused with His tag at the N-terminus was produced in E. coli.
Description:	After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
Source:	E. coli
Species:	Human
Tag :	His
Form:	PBS, pH 7.4
AA sequence:	HHHHHHFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS

Gene Name:	INS insulin [ Homo sapiens ]
Official Symbol:	INS
Synonyms:	INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10;
Gene ID:	3630
mRNA Refseq:	NM_000207
Protein Refseq:	NP_000198
UniProt ID:	P01308

Online Inquiry