Recombinant Human INS Protein, His-tagged
| Cat.No. : | INS-856H |
| Product Overview : | Recombinant Human INS fused with His tag at the N-terminus was produced in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants. |
| Form : | PBS, pH 7.4 |
| AA sequence : | HHHHHHFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS |
| Gene Name | INS insulin [ Homo sapiens ] |
| Official Symbol | INS |
| Synonyms | INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10; |
| Gene ID | 3630 |
| mRNA Refseq | NM_000207 |
| Protein Refseq | NP_000198 |
| UniProt ID | P01308 |
| ◆ Recombinant Proteins | ||
| INS-561M | Active Recombinant Mouse INS protein, His-tagged | +Inquiry |
| INS-191HFL | Active Recombinant Full Length Human INS Protein, C-Flag-tagged | +Inquiry |
| INS-60H | Recombinant Human INS Protein | +Inquiry |
| INS-2369H | Recombinant Human INS Protein (Phe25-Asn110), N-GST tagged | +Inquiry |
| INS-560C | Active Recombinant Bovine INS protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| INS-512D | Native Bovine INS | +Inquiry |
| INS-5435B | Native Bovine Insulin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| INS-5195HCL | Recombinant Human INS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INS Products
Required fields are marked with *
My Review for All INS Products
Required fields are marked with *
