Recombinant Human INS Protein, His-tagged

PRODUCTS

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Apply For A Coupon

$50 OFF Your First Purchase

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Cat.No. :	INS-856H
Product Overview :	Recombinant Human INS fused with His tag at the N-terminus was produced in E. coli.
Description :	After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.
Source :	E. coli
Species :	Human
Tag :	His
Form :	PBS, pH 7.4
AA sequence :	HHHHHHFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTS
Figure :

Gene Name :	INS insulin [ Homo sapiens ]
Official Symbol :	INS
Synonyms :	INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10;
Gene ID :	3630
mRNA Refseq :	NM_000207
Protein Refseq :	NP_000198
UniProt ID :	P01308